DPCstruct | MC24166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 82 ± 7 aa |
| Standard deviation of domain lengths | 6.95 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4PNW9 | 1-83 | MTTYGVGELSALNGVAGSYAEHVPVLHIVGAPCTGAQQRGELLHHTLGDGDFSHFSRMSEHITCSQAVLAAGNACHEIDRVLE |
| W9NVE6 | 74-151 | ITTFGVGELSAINGIAGAYAERAPVVHIVGSPERESQESRAKIHHTFNDGDYRRFAAMSAHVTVSQVDLRDFRTAATQ |
| A0A2X2XQ80 | 1-81 | None |
| A0A820LL80 | 6-90 | None |
| A0A287P5N2 | 3-84 | None |
| F9FHJ8 | 72-152 | None |
| A0A843ZJD0 | 30-108 | None |
| A0A817EPT3 | 43-135 | None |
| A0A482SLU1 | 1-92 | None |
| A0A820YPQ4 | 2-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.