DPCstruct | MC24164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 58 ± 8 aa |
| Standard deviation of domain lengths | 7.75 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 64.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484Z990 | 12-65 | LPKAGTVLNIPQQLILPDTVHEGIVINSAEMRLYYYPKGTNTVIVLPIGIGQLG |
| A0A7H4PL58 | 11-69 | QPKPGTQVLIPSQMLLPDVPREGIVVNLAELRLYYFPPGVNQVQVYPLGIGQQGLETPE |
| A0A6N8K7B1 | 69-127 | None |
| A0A2X1QBW8 | 1-49 | None |
| A0A3S4H697 | 2-55 | None |
| A0A2A6Q3X1 | 64-132 | None |
| A0A376UCR0 | 5-63 | None |
| A0A377BC86 | 12-69 | None |
| A0A376TF11 | 14-71 | None |
| A0A3B0JC88 | 22-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.