DPCstruct | MC24163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 125 ± 16 aa |
| Standard deviation of domain lengths | 15.78 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0043 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D6KJF0 | 40-167 | IPGSLSERGCSYCGAKLVIGGVLKDTIQMIHGPIGCAYDTWHTKRYPSDNGHFQLKYVWSSDMKESHIVFGGEKQLKKSILEAFAEF… |
| A0A7H4PJC5 | 1-139 | MTVRGCAYAGSKGVVFGPIKDMAHISHGPVGCGQYSRAGRRNYYTGVSGVDSFGTLNFTSDFQERDIVFGGDKKLSKLIEEMELLFP… |
| A0A0Q4BAF8 | 110-266 | None |
| A0A354VGX6 | 56-170 | None |
| A0A3C1L0X4 | 6-112 | None |
| A0A533SCC1 | 2-101 | None |
| A0A645BMG3 | 15-135 | None |
| A0A843E103 | 282-444 | None |
| A0A143XY64 | 6-128 | None |
| Q4U6T3 | 13-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.