DPCstruct | MC24162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 333 ± 46 aa |
| Standard deviation of domain lengths | 46.16 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10070 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S5JI27 | 18-359 | RAAESALRAIPPAFGLEATVAVNPFLGQSGTDLATASALMARVAGESLTRPRAEFAAMIARGEISDDDLAAALIACESPFKPVDLAM… |
| A0A2X0QV22 | 11-346 | QEVLKELKHYFPSQAQLKDFVHHNTLHAFQDQKFYDGIRSASKIFGYIVSLQLEDYRALYISKRIRENILKRIIAEKKGVEHLNEWM… |
| A0A0M2USR7 | 6-383 | None |
| A0A4R7KDU7 | 1-342 | None |
| A0A1G7WNQ6 | 2-362 | None |
| A0A532EFH6 | 1-321 | None |
| A0A1Y2MGR5 | 18-283 | None |
| A0A380EDS6 | 1-326 | None |
| A0A0N0Z5D7 | 15-395 | None |
| A0A7G1I1T5 | 2-380 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.