DPCstruct | MC24160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 163 ± 21 aa |
| Standard deviation of domain lengths | 21.03 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F8YDF7 | 105-254 | WRRLGAVLLLGVPFVDVVLLVATVIDLRRGVEANFTHGLAAAFIGFSIAFGHSLVRWADQRFAHRFAGGPPPWKPPKGGWERAQYEW… |
| A0A6L7E8A7 | 2-138 | DLILLAATYIDLRQGAVASVIHGLAAVYIGVSLAFGHQMVKWADARFAYRFAGGPKPKGKPKYGKERSVYEMVGWARHFISYVIGAG… |
| A0A830YZ37 | 2-121 | None |
| A0A060ZTW8 | 61-208 | None |
| A0A251YZJ5 | 4-176 | None |
| A0A2G5IZT8 | 13-160 | None |
| A0A364K9J2 | 10-203 | None |
| A0A7W8QJJ0 | 1-182 | None |
| A0A2Z3YQK6 | 2-179 | None |
| A0A845V2C1 | 2-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.