DPCstruct | MC2416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 173 ± 22 aa |
| Standard deviation of domain lengths | 22.06 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 51.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6RZK9 | 1-140 | MEGSPSQSGSSSSNIAVLNENIKDLKNLTKPNYLHALKLLFENLQNEFSPQSLINSLEALIDPTPFNYYSKESVIRLELHLRTWVTI… |
| A0A397W291 | 1-157 | MEERDNILSSSSSLNYDSIAKLDIKSLKSIAINHAEEFIKDFSTLDNLIGFKQLVEDFEVELPEEILIKALKLLGDASSFEYQSEKT… |
| A0A2N0PMF8 | 21-182 | None |
| A0A015JY04 | 2-176 | None |
| A0A2N0RVL8 | 1-210 | None |
| A0A2N0RV84 | 18-225 | None |
| A0A2N0R2N4 | 4-145 | None |
| A0A2N1MVP2 | 1-174 | None |
| A0A015I651 | 31-216 | None |
| A0A397W0Z7 | 1-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.