DPCstruct | MC24158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 71 ± 6 aa |
| Standard deviation of domain lengths | 6.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9EVG9 | 43-111 | RDDNVNLMDAGVRRARVERERANLMANHECTHDNWKSRQGPHQCEECYDVLPVFIYECRQCHTMACRRC |
| A0A3A2ZLV3 | 1-78 | MPRNANNADRRNAFNRAVNSLQQHENVSCNHQKDDQWAFRSRGSMECEICHDILPEYVFMCRNCLMKVCASCRRNRLR |
| A0A818Z053 | 204-272 | None |
| A0A484FB81 | 866-931 | None |
| A0A1J8PS29 | 1-80 | None |
| A0A2S4L136 | 507-568 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.