DPCstruct | MC24157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 148 ± 12 aa |
| Standard deviation of domain lengths | 12.17 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 67.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08265 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4AU01 | 79-234 | ILQNFDEQAIKDKQVQTQILFGRKMNKLAKPAHPPLCVITNHPARYRDPKTGLPYYNSYAYREIQRVYRGDYKWSKLLGAWVGRGDY… |
| A0A3A2ZHA5 | 1-124 | MCTEISSSLCVITSLPSRYRDTKTYLPYANSYAYREIQRTAAQNYSWSPMLGCYVGPVGIAARGVPERFLNPDADTTRGQEETDGNR… |
| A0A6A6UWV9 | 631-788 | None |
| A0A6V8R1L7 | 675-833 | None |
| A0A7J6J832 | 1-137 | None |
| L2FV23 | 30-190 | None |
| A0A428T5W4 | 1-143 | None |
| A0A842Z8V8 | 3-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.