DPCstruct | MC24156
Metacluster Properties and Pfam Annotations
| Number of structural domains | 232 |
|---|---|
| Mean domain length (aa) | 515 ± 140 aa |
| Standard deviation of domain lengths | 140.22 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 79.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.24 |
| Pfam Score | 96.73 |
| Assigned Pfam label(s) | CL0023- PF01576- CL0378- CL0220- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183VF33 | 47-434 | LKAELVQEMNPPKFEKTEDMSNLTFLNDASVLHNLRARYGSMLIYTYSGLFCVVINPYKRLPIYTDSVASMFMGKRRTEMPPHLFAV… |
| A0A3A2ZGN6 | 30-564 | VSTTTLLNALHSFYTAGQPYQLDAGTSLVVNSWLTATRTTPDGSNGSTIDRDLARRAWEHARRRAEDGCIVLCSTHQSTPSLLEPYL… |
| A0A6S8WDV1 | 220-1000 | None |
| A0A6A2XZH7 | 275-661 | None |
| A0A5E4QE36 | 1-403 | None |
| G4TZ95 | 19-330 | None |
| U6L5B2 | 6-405 | None |
| A0A6P6C304 | 8-489 | None |
| A0A553MZB0 | 142-519 | None |
| A0A7S1V7N4 | 1-496 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.