DPCstruct | MC24154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 90 ± 5 aa |
| Standard deviation of domain lengths | 4.56 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 78.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4PX11 | 81-170 | DWVEWWLQTDYGSKSKISWDSNHLSDVWKHYVQVAYSVDGAAKVMYKRCSTILEHPYTIKKDMNGKDGCYGTTTMIRHLKTSSCVRA… |
| A0A3A2Z5J0 | 3-88 | KNDFVRWWLQTDFGQKKPIRWDSRHQSEIWTHFDQVATAKDGTPKVMCKRCKRVFDHLQFGNGTSAMLKYMKGRGCQKGAKTPDIR |
| K9F9H2 | 31-127 | None |
| A0A370T955 | 62-147 | None |
| A0A397GKM4 | 343-427 | None |
| A0A7T6XRE8 | 1-88 | None |
| A0A1F5L466 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.