DPCstruct | MC24153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 340 ± 34 aa |
| Standard deviation of domain lengths | 33.52 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 73.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0033 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A2Z5C6 | 14-355 | SSIFIQIGDRDFQVPRDIFSAPGDSPNFFTLGFGGFFASPQEVFPGLDRTNLLRPPAIIPPCVPHRSGDLFAELLHTLRGYPVHIRD… |
| A0A1Q2YF24 | 2-310 | EPFHITVGGKKFKIPKEILTQKGNYPNYFSIIYHSLLIDPFVSNDLFIRPPPLNPYQSHRSSSLFGELLHGLYGNEIEIRNEAHRKD… |
| A0A094IZP4 | 2-324 | None |
| A0A162Z554 | 892-1244 | None |
| A0A179FRJ9 | 455-785 | None |
| A0A2N1LF64 | 551-897 | None |
| A0A4U0VZP8 | 30-413 | None |
| A0A178F8M9 | 338-734 | None |
| A0A0F4Z472 | 464-830 | None |
| A0A2S6CNM3 | 528-876 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.