DPCstruct | MC24152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 137 ± 13 aa |
| Standard deviation of domain lengths | 13.34 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 36.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6S874 | 258-406 | VRILLPDGTHPMEDIKGNGLGDVVLDAVPLQGLGAQHQAQDDHGNTKNELQVDLAVDESGILRVLMRYGVVKFIPLSSDDPIVLQQS… |
| A0A3A2Z300 | 1-133 | MDDIKLRGLGDVVFEAIPLGKLGIRSGHSLKCAILVDLAVLHEGIQRVLSEYGNIDFVPLSDKDPIILAQEPHDIASKKALAYQHMY… |
| Q4WRK2 | 130-266 | None |
| Q4WRK3 | 77-213 | None |
| A0A0A2KIB7 | 1-150 | None |
| A1DJD5 | 486-622 | None |
| W6QMW6 | 1-106 | None |
| W6PUX1 | 23-162 | None |
| A0A5M9MDH9 | 136-292 | None |
| A0A1L9SXI7 | 21-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.