DPCstruct | MC24151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 58 ± 0 aa |
| Standard deviation of domain lengths | 0.35 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 85.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 57.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C5XXP3 | 47-104 | MRAYGELVQVPEMDLGVDVVKHQKWSGASYVDELQKMVTGGVSSTAAMGKGVTEDQFH |
| A0A3A2Z1I4 | 1-58 | MRAYGELIQEPEMENKVDVVTHQKWSGANYVDNMLKMVTGGVSSTSAMGKGVTETQFH |
| A0A6S8TYP7 | 265-322 | None |
| A0A842YUQ8 | 33-90 | None |
| A0A7S2UJF6 | 87-143 | None |
| A0A0G4MZ12 | 286-343 | None |
| A0A0P1BHV3 | 299-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.