DPCstruct | MC24150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 197 ± 26 aa |
| Standard deviation of domain lengths | 26.33 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.39 |
| Mean intra-cluster sequence similarity (%) | 13.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4R885 | 1-212 | MTRLASVVALAMLLSACGRSEPEPRRDWVIHSRVVFVTEDFASEREPLPRNAFRLWFPYVSGDLYGSSNVPDYARPELAEDYSFTLD… |
| A0A2P6M6Q9 | 19-217 | ADRLADWTHGEAGIYTYDRGGPVKVGQVAADGTLVFEWPSAPSTQQTLARTYPSCLEDGSPIARPGAAEFWPTSLFIATDDSGDEEL… |
| D7JCC5 | 22-205 | None |
| A0A7W8KFW2 | 4-193 | None |
| A0A0A7KMH7 | 19-175 | None |
| A0A0K1PDF6 | 1-199 | None |
| S7X2U6 | 19-233 | None |
| A0A0G2ZG41 | 1-203 | None |
| A0A2W4J131 | 1-207 | None |
| A0A1G9WXC3 | 32-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.