DPCstruct | MC2415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 103 ± 8 aa |
| Standard deviation of domain lengths | 7.71 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 42.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6T6M7 | 5-105 | DTLQNINSATLGAQMPIVTLPDGSKVQTGTVGALIVNIRTYNELIARGPNADEKTKTELEGKMAASLPLLKKAGMFGLFAPQEWVQG… |
| A0A6B8NAR7 | 6-104 | SLAQQLSAVNHKIVAEGQVLPIVTLKDGTMIPTGTVGAMLHNIIRYNEGERGEVVQDLKLAIPALASFGLFELFTPEEWILGDNPGR… |
| A0A197JH93 | 3-96 | None |
| B3G4M6 | 60-155 | None |
| A0A819U8Y0 | 13-120 | None |
| A0A3E1NIV3 | 3-95 | None |
| A0A401KGL1 | 340-448 | None |
| A0A0A1TA74 | 51-155 | None |
| A0A2S7IQE2 | 8-96 | None |
| A0A4Q7K2I3 | 112-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.