DPCstruct | MC24149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 127 ± 16 aa |
| Standard deviation of domain lengths | 16.41 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 15.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13162 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q5SND5 | 4-143 | YSENLGNGFLYESSGKEFKNIRTPIRGQKNIYGKVMEYKFNADFILAIQQPSREIYHGSIAYELRNADRVKYKYNSTNDRIESERVA… |
| A0A2W4R4X9 | 25-159 | LARWLAFLLLAICVALPACATQRPPTVVALPNGYYLQRDKAKQPALVRRGGSVVLKGPIAAYAVHGDLVVGCVSDWKPEGAAYPSQI… |
| A0A1H4CST9 | 10-155 | None |
| A0A2R7RYP2 | 115-228 | None |
| A0A519PY39 | 1-116 | None |
| A0A8B2CB94 | 2-153 | None |
| A0A1M3FUW8 | 27-162 | None |
| A0A326KBQ8 | 2-104 | None |
| A0A5R9IPY2 | 1-119 | None |
| A0A3G8XE10 | 13-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.