DPCstruct | MC24140
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 125 ± 30 aa |
| Standard deviation of domain lengths | 29.56 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151ASJ9 | 3-91 | RAPSQIEFPGISGRENHQKRSRANQTEKLIHLTVVAEEDIELMAEFGTVALQRGRLARLLEEAYAQDAILDTPRLCVLFPQTHRGIR… |
| A0A419JC84 | 6-140 | EELERLVNKSDRQLFINELNTGFGLSQVEAEALCDRITMFNRDYYGGSRGPDQIAKTVVALGEPAGKPIKYCRMVSVNLTIYDDEDY… |
| A0A522UXW6 | 1-92 | None |
| A0A522UXW0 | 23-115 | None |
| A0A7J9TIB2 | 1-82 | None |
| K4LQL3 | 12-152 | None |
| K4LEJ3 | 77-218 | None |
| A0A497ASA4 | 7-164 | None |
| A0A661P3B2 | 10-176 | None |
| A0A3N5SD25 | 84-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.