DPCstruct | MC2414
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 184 ± 20 aa |
| Standard deviation of domain lengths | 20.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6VJJ7 | 4-152 | GQITKINSDDTDGAWYCHRCTRENAVIHYLGAHPFVQMRCGQCNHVACTDCYMTSILTPINPDILGPAPGNKYRIADIVPGHESYGS… |
| A0A6A6SWE7 | 3-199 | ILKDLFAISGSKSTVDPQYASTPLAELDNPFRSANVHGHWHCHNCGDLWHPLKYNRSLHPFSKLKCTACNWSWQPDWEMTKTARPFK… |
| A0A6A7BGU3 | 1-202 | None |
| A0A7C8MG45 | 34-215 | None |
| A0A7C8MBA7 | 1-175 | None |
| A0A6A6HX56 | 13-189 | None |
| A0A6A6AUJ4 | 92-320 | None |
| A0A6A5VTQ3 | 9-187 | None |
| A0A2T2NKE6 | 1-204 | None |
| A0A6A6THZ7 | 23-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.