DPCstruct | MC24133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Standard deviation of domain lengths | 6.16 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.42 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0546- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661TZV6 | 222-282 | SSELIPYRYNGTLYCNYLGNYWDDYNGSDADGDGIGDSPYVINGDNKDFHPLIKPFTEYEL |
| A0A368TEG4 | 25-93 | ITYTYNGNTCINFMGNYWSDYSGNDTNDNGIGDIPYNLDSNKDIYPLIDPIEHYLELIEKQKGLTYVGF |
| A0A7G9ZB91 | 3-66 | None |
| A0A7G9Y1M8 | 40-102 | None |
| A0A7J9PHY4 | 2-70 | None |
| A0A7J9RZX1 | 49-103 | None |
| A0A7J9SE84 | 497-572 | None |
| A0A0E3S8H0 | 61-129 | None |
| A0A832CZP2 | 184-239 | None |
| A0A0E3SBZ1 | 248-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.