DPCstruct | MC24131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1527 |
|---|---|
| Mean domain length (aa) | 168 ± 26 aa |
| Standard deviation of domain lengths | 25.78 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 76.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 12.10 |
| Pfam Score | 38.15 |
| Assigned Pfam label(s) | PF10272- PF20456- PF19124- CL0028- CL0425 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L7Q1M0 | 49-228 | APPADIGEIVTAQTTLKSTKEPFAVGPRFLLVFGLSGAVGFGAFTLTKLSMMNPNDARDLGLFLGGMGAIVTAIVVILLTRFRHTCS… |
| A0A2V3J8G3 | 193-352 | IKGHQPPALPKIMGQTFKPTMRSFIRSFIWTISPAVTALLLIYIRFRYEKTGLISILLGVLGGLSSLYLILQTIIVHLQKITLLDEG… |
| A0A7C5N451 | 4-165 | None |
| A0A0Q7VRP6 | 8-127 | None |
| A0A1Y4I241 | 11-194 | None |
| A0A1F6Q6Q3 | 140-292 | None |
| A0A1H1G5N2 | 6-139 | None |
| A0A3E0GG67 | 149-294 | None |
| A0A6L5ESN1 | 1-167 | None |
| A0A1F8P4X8 | 8-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.