DPCstruct | MC2413
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 228 ± 21 aa |
| Standard deviation of domain lengths | 20.52 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5YEQ3 | 3-182 | PRSQQPGPNLVAIEKLGRLERRVAREPSGSVLYQALVTLRDHVKGCTTHLDPQSDEPNSLPGKLCVGYYEPFKVRAYVKKRNGKVYV… |
| A0A6A6SVL9 | 12-234 | RTLAAVQEWAQAKFPLDFAKLPDHTTLNFMSFQQEAWCREMGMLQVPTVALHVGACSHGRTPGFQLYAIVHGEPLTYTKVAWIAKCG… |
| A0A6A6ACQ1 | 8-238 | None |
| A0A6A5ZAB5 | 15-244 | None |
| A0A178B172 | 232-467 | None |
| A0A6A5VVX9 | 2-219 | None |
| A0A6A5W1J2 | 15-248 | None |
| A0A6A6ZG18 | 244-452 | None |
| A0A6A6ZB81 | 6-221 | None |
| A0A162YP55 | 226-489 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.