DPCstruct | MC24129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 77 ± 9 aa |
| Standard deviation of domain lengths | 8.84 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 49.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A855HP91 | 1-88 | RIGVTRAHLEEDAGKSIHDQFEGQSGIDLNRAGTPLLEIVSEPDMRSVEEAVAYIKSIHTLVRWLGISDGNMAEGSFRADCNVSLRRP |
| A0A2H3JQ65 | 31-106 | VRIKQMQLQQDTGKSTFDPLQGLSSIDLNRAGAGLMVIVSEPDMRSPEEAGTYVRALQALLRAIGASDGNMEQGSL |
| A0A359N1X6 | 1-66 | None |
| A0A287I6T8 | 44-139 | None |
| A0A044V152 | 80-164 | None |
| A0A059X2H7 | 44-115 | None |
| A0A380P2J4 | 1-66 | None |
| A0A554KBI1 | 47-130 | None |
| A0A340WNG3 | 107-185 | None |
| A0A0K9S255 | 75-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.