DPCstruct | MC24124
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 224 ± 17 aa |
| Standard deviation of domain lengths | 16.52 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N0L937 | 1-231 | MLNSEQYDVAQFSIAKCTKKNEESYEIPYIEEIVRKTADFLDYEGNVEGIVRYVESKVNCRMDLGTSVVSEEAEHDKDWVKRIESSE… |
| A0A844F3P9 | 11-217 | ILLIISARLELMKELSGFVPSLENIKPAIEDAIAFSGIDCDEEDKNKLLEEIEYREKITHVLGNIIYDDYEQKKWYFNDKVDDSYFW… |
| A0A4R2ZHF3 | 3-238 | None |
| A0A2R5FAR4 | 3-215 | None |
| A0A7K1GPN9 | 5-225 | None |
| A0A5M9GZE6 | 6-239 | None |
| A0A2R8A2B2 | 2-222 | None |
| A0A2C9A6R4 | 1-243 | None |
| A0A7S9DXK3 | 3-236 | None |
| A0A1D3DS52 | 15-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.