DPCstruct | MC24120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 135 ± 18 aa |
| Standard deviation of domain lengths | 17.58 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 47.95 |
| Pfam Score | 98.39 |
| Assigned Pfam label(s) | CL0456- PF00330 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6BZ23 | 2-135 | SNPFVHLAEPLDPAQPGKKFFNLNKLDDSRYERLPFSIRVLLEAAIRNCDQFLVKKNDVENILNWNIMQHKNIEVPFKPARVILQDF… |
| A0A844EXG4 | 9-156 | SKDTLQAKDKTYHYYSLPLAAKSLGDITRLPKSLKVLLENLLRWQDGNSVTEEDIHALVGWLKNAHADREIAYRPARVLMQDFTGVP… |
| A0A7R9KP80 | 223-349 | None |
| A0A2T2URA5 | 21-164 | None |
| A0A534BGN1 | 2-153 | None |
| A0A6G3UZV9 | 2-137 | None |
| A0A6I9Z1Z7 | 13-136 | None |
| A0A534TEX8 | 11-148 | None |
| A0A5J4JI69 | 19-139 | None |
| A0A7N0TFJ0 | 107-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.