DPCstruct | MC2412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 207 ± 24 aa |
| Standard deviation of domain lengths | 23.86 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9MWM7 | 4-187 | WVTKEWKQKRQIALKDLCEQCSTKEGILVLHHLEQPPSSNDIRYKVTCTMLDEALKAGKVTYQTTKRDACPNCQLLSITYRKTMNPP… |
| A0A1Q9P4X3 | 8-213 | KVTTKPWQTKRWREMRKRTIGDSCTQCGSEKKPLVIQHLNHPPKFSSIARKVRNKYLKKKLMLKKYRSKINKIELTKMERKACPKCD… |
| A0A523RBD1 | 42-290 | None |
| A0A257AFH4 | 3-209 | None |
| A0A3R9NEQ7 | 152-340 | None |
| A0A7W4CGF2 | 2-170 | None |
| A0A0F8Y2Q7 | 55-298 | None |
| A0A3D4YVK5 | 10-200 | None |
| A0A7W8JZC4 | 31-232 | None |
| A0A7W8JX88 | 1-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.