DPCstruct | MC24118
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 84 ± 11 aa |
| Standard deviation of domain lengths | 11.43 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11453 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2RXF7 | 62-149 | DAYRGYHFRILSRQGEAAAGGAYDYLVHGRMLAGFAMVAYPADYGSSGVMTFIVNQNGVLFEKDLGEDSTALGAKMDTFDPAGWTVVA |
| A0A366FAF0 | 9-76 | YRFRIIDSNQSDGFALIAWPVEYGETGVMSFIVSQDDRVYQADFGEETAKNVAAITRFDTQAPWQPEE |
| A0A158L7B3 | 68-154 | None |
| A0A841HPJ5 | 223-309 | None |
| A0A1G2YXL0 | 7-64 | None |
| F8GS43 | 67-135 | None |
| A0A0A8WTY1 | 232-317 | None |
| A0A2V9TCY0 | 301-394 | None |
| A0A7G8BNX9 | 182-280 | None |
| A0A7T8NMZ9 | 194-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.