DPCstruct | MC24111
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 7.52 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 94.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 46.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0635 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X8C2M8 | 1-97 | MLIAGGSAYGLAAADGVMRWLEERGRGVAMAGGVVPIVPGAVIFDLDVGDWGCRPTAEFGYAACDAAGVEVDVGTVGAGVGPAPACS… |
| A0A420F0Q0 | 90-172 | VMLGGSSMYGLAATDGVIRWLEERGEGVRVGGGVAPIVPAADIFDLGRGGNIRARTTPAWGWLAAENAHAGAVAQGVVGGGTG |
| A0A0N0BMI8 | 69-149 | None |
| A0A1P8YDG1 | 1-66 | None |
| A0A2X4V2A6 | 1-91 | None |
| A0A4R3EMM9 | 63-128 | None |
| A0A6F9EIC7 | 1-81 | None |
| A0A511R2D1 | 69-152 | None |
| A0A399Z277 | 62-145 | None |
| D4JFJ1 | 2-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.