DPCstruct | MC24109
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 216 ± 37 aa |
| Standard deviation of domain lengths | 37.43 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18085 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A540R548 | 1-170 | MTEATVHPEAALSPTKDELCAELSAITERLGSYRAVDPDGEVGIEVIIGRTFSGELGQLFLSYRAADNATKKEIARMDHSVLGERSV… |
| X8BK08 | 9-200 | WSDWLPQQRWYAGRNRELASASAHTSVALRENLDLVLVDVAYTDGSSERYQVLVSWDTAPLSEYTTVATIGAAGDRTGYDALYDPGA… |
| A0A239CAL5 | 14-200 | None |
| R7WSW6 | 7-167 | None |
| A0A814E4G0 | 22-251 | None |
| A0A433FLU7 | 3-219 | None |
| A0A1C5JZH6 | 76-302 | None |
| A0A1I1Y749 | 7-247 | None |
| A0A4Y8TU65 | 2-134 | None |
| A0A399EM61 | 9-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.