DPCstruct | MC24107
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Standard deviation of domain lengths | 5.09 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 62.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0139 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X8ARL5 | 1-61 | MGPMNTLNSASLVNKGLELIETHLLFGVPYERIDVVVHPQSIVHSMVTFTDGSTIAQASPR |
| A0A1F8LM19 | 112-184 | ARPEDALAHPTWRMGAKITVDSATLMNKGLEVIEAHWLYAIDYDRISVVIHPQSIIHSAVEFVDGSLKAQLGL |
| A0A1L8ZF86 | 69-140 | None |
| A0A0B4EYJ7 | 24-94 | None |
| A0A1I8ALY7 | 88-160 | None |
| A0A379WFR4 | 1-74 | None |
| A0A539D5P0 | 1-60 | None |
| A0A811P1F4 | 281-352 | None |
| A0A1I7YI71 | 47-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.