DPCstruct | MC24105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 257 ± 44 aa |
| Standard deviation of domain lengths | 44.00 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 91.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.14 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF21074- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534BXF7 | 2-321 | NIKILLNPLVAERKLSRGDRNRLLSRQTSEVASLVLRNNYLQSQALSTLEAQSAARLPEFQHLIRSLERSGELSRALEFLPSDDELA… |
| X7ZGJ9 | 58-289 | LPSEKEIRRRAEAGIGLTSPELATLMAHVKLALKDEVLASDLPDQEVFAARLPHYFPSVLRDRFRSEIRSHQLRREIVTTMLVNELV… |
| A0A7C8DPU6 | 2-278 | None |
| A0A800AS75 | 296-505 | None |
| A0A539CV76 | 160-392 | None |
| A0A1S4LM15 | 533-770 | None |
| A0A850DK23 | 2-346 | None |
| A0A4Q8A8T4 | 5-230 | None |
| A0A455U3N6 | 1-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.