DPCstruct | MC2410
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 74 ± 4 aa |
| Standard deviation of domain lengths | 3.82 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 94.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9P024 | 24-97 | DNILQEFKLEYLEARITHKGLHSYHEGYAVLKEEIEELWDEIKKRSPVNDKLFKEAIQVGAMALAFIHELLETP |
| A0A0F9CW33 | 6-77 | DRFGRITDLIFDEFSSAMKKFGSFNSIHEGYAIIHEELDELWDNVKLQHPHPEDLKKEAKQVAAMAIRFLYD |
| A0A661D5U7 | 94-165 | None |
| A0A0F9BZR2 | 2-75 | None |
| A0A1Y0C1Y4 | 6-88 | None |
| A0A7C5J456 | 43-115 | None |
| A0A4R7AA74 | 51-122 | None |
| A0A098AXC2 | 4-71 | None |
| A0A4Z0QTP7 | 5-80 | None |
| A0A0F9SQ74 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.