DPCstruct | MC241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 313 ± 40 aa |
| Standard deviation of domain lengths | 39.85 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 17.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9IIK6 | 21-317 | VDPAAAQVDQQRAEAYFKEADAICQRDGGRLWGISLCGPMVIADARTRTLATSQARPIGEEPRSIGFAKAPIEWGGAPWAAYIWDFI… |
| A0A7V9UKQ7 | 6-292 | SDRVWKGWSKTPFAVLLVTPEYEFLVRHPKPSKDFIYIGYDPLLNSEVYFRKLVFQKQLLATMPAVGGVSTIVIGQPENTDAKTSTR… |
| A0A554A257 | 3-283 | None |
| A0A3A9GQA2 | 18-320 | None |
| W2CAK8 | 30-259 | None |
| A0A7Y4ZN31 | 2-303 | None |
| A0A2W4ZFH7 | 11-318 | None |
| A0A432WFY5 | 3-335 | None |
| A0A1I6R8M6 | 5-228 | None |
| A0A6I4ZNA3 | 10-299 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.