DPCstruct | MC24098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 53 ± 3 aa |
| Standard deviation of domain lengths | 3.35 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 47.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A495RTV9 | 1-53 | MPNPTTRSEAISAKCRDCIYDPGAAGTWRQQVAACESGNCPLFDFRPCPPKRK |
| A0A246JYJ1 | 1-55 | MTTKPRVSMRAAINAKCKSCIYDPFAKGLGSWREQVADCCSSNCPLHPIRPTPRE |
| A0A370DJN6 | 11-65 | None |
| A0A370DI03 | 1-48 | None |
| A0A5C7PVR7 | 2-55 | None |
| A0A351V4W5 | 3-62 | None |
| A0A1M6EUD5 | 22-72 | None |
| A0A395LLS9 | 1-57 | None |
| A0A874BHB4 | 33-81 | None |
| A0A2H6FZA4 | 63-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.