DPCstruct | MC24097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 180 ± 27 aa |
| Standard deviation of domain lengths | 26.94 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 17.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y7M2C3 | 11-173 | SGKTELFPGFDLWNEVTHRLVDYHGYDLEAVVRLVNERYEISTLTVRQRPGGDAITGIGLRGIKPAAIVRNTMIANAGLVLWPRFAF… |
| A0A1S1M3D6 | 16-195 | QRIRWRFSRDNETLDGVEVPTWIEATYVGGPTPDMVTRIELRDRAPRIVELSFIAQRDQNEVQQKHLRAVDVDRLATDLLAQWISWH… |
| A0A2W6V8V4 | 4-182 | None |
| A0A101TN38 | 2-185 | None |
| A0A7W0PUE3 | 54-265 | None |
| A0A5S5CXA4 | 36-215 | None |
| A0A5J5DVH7 | 33-205 | None |
| A0A561WAR8 | 2-130 | None |
| A0A848K7I1 | 1-179 | None |
| A0A7K1LHV5 | 12-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.