DPCstruct | MC24096
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 181 ± 29 aa |
| Standard deviation of domain lengths | 29.46 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 16.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0193 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A511YA05 | 2-167 | NEDRIEVPPVKLEDINGNYKGRLITVQGELRSEKVVDFKIKKDTLTFPEFPLKEIVMAVVKDPVKTQSAIAAMGKVKYNLNYTTVLN… |
| F9D688 | 31-209 | ENDSPKSLTKEEVKAAFETVKGTYKGSVIFPATNPKNAKDVTDTLDVNWTIATDSVMTIDNLPAQALVPAISDEALGKALAQQQAQS… |
| A0A7D4FZR0 | 6-176 | None |
| A0A1Q6HGX9 | 5-185 | None |
| A0A3D1HJU4 | 19-252 | None |
| A0A132GPL2 | 9-164 | None |
| A0A6I3LKG1 | 25-184 | None |
| D8DVC3 | 10-185 | None |
| A0A1Q6GZ54 | 14-137 | None |
| A0A7X9GS28 | 2-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.