DPCstruct | MC24093
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 207 ± 29 aa |
| Standard deviation of domain lengths | 28.62 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07165 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B6J3Z3 | 1-193 | MYAKEEIMFCLRKLINYTEIKIEIERAKPTGDLDVVFKKYCRKSPQLRYCVTNFTEAIEPCLSPEERYMKQTILNITDALIRFICFK… |
| A0A7J7A1V8 | 13-186 | TAYDHLLDILEEFNEFFTENFNLTLVYRANESEKKFALHQFLRDQCCKKHEYIKRIKAVSVALQSCARDDEIFAISTGANILNKSVE… |
| B0WT40 | 2-219 | None |
| A0A6H5IF11 | 2-172 | None |
| A0A6H5FV53 | 463-664 | None |
| A0A084WKF1 | 1-196 | None |
| A0A7R8XLB0 | 139-351 | None |
| A0A5N4ADP2 | 52-241 | None |
| T1H8Y2 | 6-164 | None |
| A0A7J6YLX4 | 115-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.