DPCstruct | MC24092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 194 ± 31 aa |
| Standard deviation of domain lengths | 30.99 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I9GCD3 | 6-159 | YIVPPDPFHSLVFTLDAANLNKCEVDIAFPRLLAELDLSPENQKLLLDQPIEKKCLMLTEQNAIRDKYGIGNSKIAEKFLEIIQGNS… |
| A0A7J6ZS40 | 1-189 | MVPKRFEERGPRIATGTLSASRPTSETDFGEPDENLLKLYEQQINSMDPKETDKKFEELLNDMNLNEDKKMPLRQYTQDNKKKMLIM… |
| A0A811L3E6 | 3-186 | None |
| A0A5N5SUA9 | 108-272 | None |
| S9Y246 | 2-239 | None |
| A0A2P6MNC2 | 144-382 | None |
| A0A7J8AU06 | 38-243 | None |
| A0A0N5CLL7 | 5-182 | None |
| A0A6P8H7I6 | 1-180 | None |
| A0A6F9B6D1 | 1-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.