DPCstruct | MC2409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 152 ± 23 aa |
| Standard deviation of domain lengths | 23.18 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11827 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1FVR2 | 6-107 | MDKMTSGQHDVWMKYEKQLSYDAEHIKGITETEHQREHFVALSKNMYEVMKSIKMDVPVYYDFCPMANNGKGANWLSLQKPINNPYM… |
| M2AD14 | 19-176 | NEPVVLTGESAEQFDRAYAAYFAIQKALAADQSPPPLEMNKLDESLGMVTRLADVPDEAQSHLQSAKRSLARMQGSLEQVRKSFRPI… |
| A0A3M1B3N9 | 569-733 | None |
| A6DK98 | 473-633 | None |
| A0A354KCJ1 | 9-127 | None |
| A0A7Y4X178 | 57-237 | None |
| A0A3M1GQ38 | 341-528 | None |
| A0A1Z8MQ99 | 12-155 | None |
| A0A1V3QY49 | 98-193 | None |
| A0A3R8K9Z5 | 257-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.