DPCstruct | MC24089
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 151 ± 30 aa |
| Standard deviation of domain lengths | 29.96 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 89.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 43.61 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0292- CL0061- CL0697 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A081DAV5 | 2-137 | IIDCRPFKEHGIEVVDIAKRLMDYGFHAPTVSFPVNGTMMIEPTESESKEEMDRFCDAMISIRKEIAECSSDNPNNVLKNSPHTLQM… |
| A0A7J6ZI06 | 150-299 | VAHECIVRFSEKFKSLGIEVADIAKRLMDYGNSHAPTVSFPVAGTLMIEPTESESKAEIDRFAEALISIRKEIDEIAEGVADAENNV… |
| A0A2G4GYT4 | 456-621 | None |
| A0A2N5VFX9 | 16-174 | None |
| A0A838RXR5 | 2-131 | None |
| A0A379GF62 | 2-124 | None |
| A0A6J6RC71 | 17-187 | None |
| A0A672PZ30 | 593-768 | None |
| A0A7R9DJY9 | 42-174 | None |
| A0A5N5HQT1 | 2-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.