DPCstruct | MC24088
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 110 ± 11 aa |
| Standard deviation of domain lengths | 11.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03722 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182SV15 | 4-134 | LTQKFHGLLQHPLEPLFLPKNNGTLFYELPERFLTPRYRPIGQNLVNRFGPNSAASTEVSNDTGVPPMVVTIRDLKELPDLSFATWI… |
| A0A7J6ZFM2 | 3-120 | TNNNKYLALMFDRPQEPLFAPKGPHNAVFRVPQSYLPDRYKPLGMQLSQIFDDEVEETIYIKEIELPDVGELLKLDRNGHFSLFVPW… |
| A0A6P8ZI14 | 36-145 | None |
| B4HN96 | 1-122 | None |
| A0A4C1U338 | 55-168 | None |
| A0A7E5WY17 | 2-123 | None |
| A0A084W7C2 | 1-103 | None |
| A0A7J6ZUB9 | 2-86 | None |
| A0A811ULM2 | 1-103 | None |
| B4IPC2 | 1-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.