DPCstruct | MC24086
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 93 ± 4 aa |
| Standard deviation of domain lengths | 3.89 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 83.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N7Z4A9 | 233-324 | IDLFWIYYPDARQVLTTNFIFNAKNSTSDITFDDVLNQRRFSSIIYKSDNGLGKGGSGVIDEYIPNDADGQIEESDRIKAQILQMEN… |
| A0A7W1Z735 | 171-259 | VGVRPLFWIYFPDARSYLARAAVFNRRNDAARMSYDELFTKRMFSSYVYKESNVYNRSISDYKQGLDVLLESEDIKEEIFEYESDLW… |
| A0A848ZP38 | 127-215 | None |
| A0A2E6N7S9 | 1-93 | None |
| A0A2D9RVF9 | 94-194 | None |
| A0A7C5JMD3 | 79-172 | None |
| A0A645FDI0 | 11-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.