DPCstruct | MC24085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 110 ± 19 aa |
| Standard deviation of domain lengths | 19.18 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.71 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0306- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7AWA3 | 2-82 | NFIKLLPNEVPGATLKIDLIEDHTVRKLKRWLECRGWQPTGRKEDLIERIQNCITNGRKNEIVAGVDNGKWCDRKCADANQ |
| A0A7J6Z538 | 1-114 | MATVKVILEPKDVPGAMLREGVDIKDHSNLELRRWLECHGLKKLGNKVELIERVSNCINAGRADHISLAIDGGKWYDANRQMLVAPT… |
| A0A6J8DEB0 | 5-102 | None |
| A0A6J8DQU9 | 1-120 | None |
| A0A2B4SLR6 | 5-98 | None |
| A0A6J8B3A7 | 5-99 | None |
| A0A2B4RR59 | 5-100 | None |
| A0A2B4RXZ7 | 1-99 | None |
| A0A3M6UGG0 | 21-141 | None |
| A0A6P8HNX7 | 1-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.