DPCstruct | MC24084
Metacluster Properties and Pfam Annotations
| Number of structural domains | 120 |
|---|---|
| Mean domain length (aa) | 172 ± 27 aa |
| Standard deviation of domain lengths | 27.23 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.61 |
| Pfam Score | 86.44 |
| Assigned Pfam label(s) | CL0187- PF04294- CL0593 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K0NA41 | 9-217 | GITQKISSFTQQFPYAAYRVQNIGEAARRVNGTLLMPGETFSMNDTIKERTVANGYTVGFVIGAGGVFAEELGGGVSAATTTMWTAA… |
| A0A7J6Z4G9 | 250-435 | QISTSQEIKSNAYFANKIHNIDLAIQTLNGVIIQPQQIFSFWHLVKAPTLKNGYKAGRNLVNGVISEDLGGGICQISSSLYISALKA… |
| A0A6L6GVJ3 | 169-351 | None |
| A0A521TRE7 | 121-356 | None |
| A0A347AIJ7 | 190-328 | None |
| A0A1C5JNH0 | 15-157 | None |
| A0A6B8RP06 | 124-278 | None |
| A0A7H5F0I5 | 37-198 | None |
| R6VZ25 | 151-308 | None |
| A0A399ESR1 | 131-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.