DPCstruct | MC24083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 116 ± 26 aa |
| Standard deviation of domain lengths | 26.29 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 91.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.32 |
| Pfam Score | 91.30 |
| Assigned Pfam label(s) | PF14272- PF02502 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I1P133 | 11-90 | AEMVANGEVDRGILVCGTGIGMSIAANKVNGIRCALVHDTFSARATREHNDTNMLAMGERVIGAGLARDIAKIWLTTEFE |
| A0A7J6Z008 | 439-552 | IINIGTNSSESADYPEFGKKVAEAVVTDKGSVGIVICGTGIGISIAANKVKGAIAALVYEEALAKITREHNDANILALGARVIANEK… |
| A0A374AV20 | 170-293 | None |
| A0A564Q952 | 2-70 | None |
| A0A1F8F1K8 | 19-145 | None |
| E0QPV3 | 52-184 | None |
| A0A4D4KRZ9 | 7-93 | None |
| A0A6G3VT01 | 2-70 | None |
| A0A6L7UAT5 | 62-204 | None |
| A0A7Y5UT53 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.