DPCstruct | MC24082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 202 ± 33 aa |
| Standard deviation of domain lengths | 32.95 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13566 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A855HM96 | 2-122 | YTFLSEQLIAFQHLFNFAIYVFQSPFSIEKNYGHADVLGVSQWTKQVGREKHRMEAFVRFKKTQEGLFISLVRPDFNVLPLIEKHFK… |
| A0A7J6YZ78 | 314-539 | SIKIYATTFTTVGPFILNGKFKELDVLIASQNSLQSSLLDETIFVESNEIHADRVWKAFKQKVSSNTLRNFYYTFLSEQESAFQHLF… |
| E0MR98 | 10-247 | None |
| A0A270AXL6 | 16-196 | None |
| K2PTJ4 | 76-291 | None |
| A0A844TBZ5 | 35-234 | None |
| A0A3A5GD42 | 47-204 | None |
| A0A2E3EIZ7 | 33-237 | None |
| A0A2D5P3T6 | 2-199 | None |
| A0A7X8HFD9 | 60-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.