DPCstruct | MC24081
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 353 ± 55 aa |
| Standard deviation of domain lengths | 54.94 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.05 |
| Pfam Score | 59.68 |
| Assigned Pfam label(s) | PF14778- PF20908 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S0U355 | 2-353 | WKVDFDHLFENYRNNSRYQENGTVAALLFGNASLANITNVLFGCLSDFDATLDLIRFIESSLPSNITFLGVLSLVNVEYPFDLNSLA… |
| A0A7J6YYK4 | 295-638 | QFVRLINVKEPSRGNIYGILHSNTLVVVGVYIQDEDKTDITQGFPTEIDIYGVIQIGNEAIDEEKIKQILNEVDVTDTPLYITCKFD… |
| A0A0N4TMH4 | 471-834 | None |
| A0A7S2MTW2 | 8-348 | None |
| L8H7J7 | 1-425 | None |
| E9J0W0 | 43-348 | None |
| H2N4D3 | 1-312 | None |
| A0A0D2MD53 | 4-391 | None |
| A0A3Q0J8G8 | 50-396 | None |
| A0A2B4SEQ3 | 5-361 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.