DPCstruct | MC24076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 167 ± 8 aa |
| Standard deviation of domain lengths | 8.13 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4UWH5 | 891-1058 | FLDSLVNEFADVFDSQIFLSQPPDPNDSPAPSTVYKFRHFITAIKNLQKINGGKFGLWLGEGCDERSKKIALVNIAAFLGQAMRETI… |
| A0A0F6VYP8 | 96-254 | VSGVPGIDSVLLGDPTRFDEEVLISQNPDLSWRPSRIYKWRDFVQAVTTMHTRGIGDMRLWLGEPGDPEPARSRYALVNLAAFLAQS… |
| A0A090RPV2 | 1-153 | None |
| B8BYD8 | 221-394 | None |
| A0A7S2SP94 | 1-172 | None |
| B8C4X1 | 341-500 | None |
| K0T6I4 | 795-970 | None |
| A0A2R5G844 | 446-620 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.