DPCstruct | MC24075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 150 ± 15 aa |
| Standard deviation of domain lengths | 14.76 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 26.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M7LKL8 | 2-157 | EVLKILDQRVPVFILFNNYFKVKPTIHLGHLAQRVEKNILDDEYYDYGNLCLLKLLGFTAKELSELGNTPSPNISDTNALKAYKDRL… |
| A0A7Z2PW72 | 88-226 | KAKALVLGWVPTFIYIADFPELSGHQNLAEYVKRRDDNQPETEAEKNFARLAKVAGFDPKEINSLQSDHEKRQTLLSRASALITQEM… |
| A0A438SFW1 | 1-164 | None |
| A0A518YFY3 | 51-203 | None |
| A0A839EKB9 | 18-170 | None |
| A0A8B3CNA7 | 1-178 | None |
| A0A7T9JNH1 | 358-493 | None |
| A0A438U6B9 | 136-290 | None |
| V8CJ38 | 399-522 | None |
| A0A147K4S0 | 118-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.