DPCstruct | MC24074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 4.52 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 44.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7XY64 | 35-111 | PHISYANCGLPYYIGGVIKEREKLLVQTPESFGTRFNIDIRIHSLVSAIHPDKKEIIVQSLKTGETYTESYDKLVLS |
| A0A3M7LJV3 | 3-67 | LSFANCGLPYHIGGDIKERSNLLLQTPESFLARFNVDVRTMNEVLRINRAAKTITVRNLLDQSEY |
| A0A7C6JZU0 | 35-107 | None |
| A0A388PJT2 | 141-212 | None |
| A0A562HZG9 | 1-81 | None |
| A0A1V1P2H1 | 44-120 | None |
| V5WEB4 | 36-106 | None |
| A0A1H0BB17 | 36-112 | None |
| A0A7R9VJ08 | 112-188 | None |
| A0A4R8WDY9 | 354-430 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.