DPCstruct | MC24073
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 223 ± 15 aa |
| Standard deviation of domain lengths | 15.44 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 18.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L9DV33 | 83-309 | ILQIICINNEDQKIDEIQNIFASKPYGVLQDFAPDYLKTQVDQSISHFFEEVYIPSSENPNENSNNFIKLINNEDLDDTHKEWLIEN… |
| A0A3M7LJ62 | 9-218 | QAILGEEDITPLHTRNFTAIRATNSTVLIERIESNFGNYLRNILLAIQTNTEEETSAILDVVRREEIDLNTIQEFLEQQTQQLPTLE… |
| A0A381E5H6 | 303-519 | None |
| A0A2D9DGL1 | 149-367 | None |
| A0A6B0PLV4 | 700-940 | None |
| A0A6B9ZML6 | 9-210 | None |
| A0A5E8K5M0 | 205-404 | None |
| A0A0Q6K6Z5 | 17-239 | None |
| A0A811ARA2 | 1-241 | None |
| A0A829CB32 | 584-829 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.